PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G13460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 293aa    MW: 32476.9 Da    PI: 5.9876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G13460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l+ +v+  G g+W+  ar  g++Rt+k+c++rw++yl
  ORUFI01G13460.1 23 RGPWTVEEDAVLAGYVAANGEGRWNELARAAGLRRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding53.94.2e-1776119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T++E++l+++++ ++G++ W++Ia++m+ gRt++++k++w++
  ORUFI01G13460.1  76 RGDFTPQEQLLILELHFRWGNR-WSRIAQHMP-GRTDNEIKNYWRT 119
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1681870IPR017930Myb domain
SuperFamilySSF466899.73E-3021117IPR009057Homeodomain-like
SMARTSM007171.4E-112272IPR001005SANT/Myb domain
PfamPF002491.4E-132370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-212477IPR009057Homeodomain-like
CDDcd001675.17E-82570No hitNo description
PROSITE profilePS5129422.45371125IPR017930Myb domain
SMARTSM007176.5E-1575123IPR001005SANT/Myb domain
PfamPF002494.7E-1676119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2378124IPR009057Homeodomain-like
CDDcd001675.19E-1179119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDAPCGWTTS AAAAVAEEED VRRGPWTVEE DAVLAGYVAA NGEGRWNELA RAAGLRRTGK  60
SCRLRWLNYL RPDVRRGDFT PQEQLLILEL HFRWGNRWSR IAQHMPGRTD NEIKNYWRTR  120
VQKHAKQLGC DVNSRQFKDV MRHLWMPRLV ERIHAAAASS ERAAPPPCAA APASHSGMCH  180
SPDPSTTTSS TAGSSVTHGE QFPSSTNHHL MTMASVTTAA ADWSSEQCGS GSATSTSVGI  240
SYDMFEGSWS ELLARAYDDD GADSSLLPDF QMADTGDNCW WSNLEDIWSQ QPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-232011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2416150.0AK241615.1 Oryza sativa Japonica Group cDNA, clone: J065186D02, full insert sequence.
GenBankAP0028830.0AP002883.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0487H02.
GenBankAP0031400.0AP003140.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0025P13.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630818.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A0E0FKK40.0A0A0E0FKK4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MV380.0A0A0E0MV38_ORYRU; Uncharacterized protein
STRINGLOC_Os01g19330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-79myb domain protein 112